PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Zjn_sc00086.1.g00610.1.am.mkhc
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Zoysieae; Zoysiinae; Zoysia
Family Dof
Protein Properties Length: 416aa    MW: 42553.7 Da    PI: 9.9946
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Zjn_sc00086.1.g00610.1.am.mkhcgenomeZGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof99.22.8e-31253306558
                          zf-Dof   5 alkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrkn 58 
                                      ++cprC s+ntkfCyynnys sqPry+C+aCrr+Wt+GG+lr+vPvGggr+++
  Zjn_sc00086.1.g00610.1.am.mkhc 253 PRQCPRCGSANTKFCYYNNYSRSQPRYLCRACRRHWTEGGTLRDVPVGGGRKNR 306
                                     679**********************************************97654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5088426.021254308IPR003851Zinc finger, Dof-type
PfamPF027012.0E-29254306IPR003851Zinc finger, Dof-type
PROSITE patternPS013610256292IPR003851Zinc finger, Dof-type
ProDomPD0074782.0E-16261299IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 416 aa     Download sequence    Send to blast
ILLTGEEELA GSEKSRALRA PTSSSSPVPV AVARHHPSKL YTRQARACMR CRGSTHGLAE  60
FILRRKEASD ALGAAEAAPP DPSRPIEAAA GGVSGCPQCA LFAVAPAGLR LFLSAIEEQL  120
CRRGRLINGP APTCTERHRG TPAAASAPRS TTPSPPSATS CRGRRRAAGT AMPSSSFLAA  180
SPSSSASSLP YLIPARPPSL LTGQGHGVNS DVGGVPTSGV GDIVVSAASS VAPPSTGSRH  240
AGARHPPQPR PPPRQCPRCG SANTKFCYYN NYSRSQPRYL CRACRRHWTE GGTLRDVPVG  300
GGRKNRRGGG GGAAAKASSS SAPVLPLGAG NGSADVAFPD VLRQVLFQPV GSVSGAGYSI  360
DLSSWQQMTA ATAPPQGTGG DANGALGLGG TSTMDAHCGA LQYWSGWQQD DVPGLD
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9672439e-75EU967243.1 Zea mays clone 300623 hypothetical protein mRNA, complete cds.
GenBankKJ7279859e-75KJ727985.1 Zea mays clone pUT6101 C2C2-DOF transcription factor (DOF13) mRNA, partial cds.
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP14037367
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G50410.12e-17OBF binding protein 1